+ Site Statistics
+ Search Articles
+ PDF Full Text Service
How our service works
Request PDF Full Text
+ Follow Us
Follow on Facebook
Follow on Twitter
Follow on LinkedIn
+ Subscribe to Site Feeds
Most Shared
PDF Full Text
+ Translate
+ Recently Requested

Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius)



Characterization of an amidated form of pancreatic polypeptide from the daddy sculpin (Cottus scorpius)



Regulatory Peptides 16(3-4): 261-268



The primary structure of pancreatic polypeptide from the teleostean fish, Cottus scorpius (daddy sculpin) was established as: YPPQPESPGGNASPEDWAKYHAAVRHYVNLITRQRYNH2 The presence of a COOH-terminally alpha-amidated amino acid was established using an HPLC method of general applicability. Although the peptide shows strong homology towards anglerfish pancreatic polypeptide (86%), homology towards porcine peptide YY (PYY) (61%) and porcine neuropeptide Y (NPY) (61%) was greater than towards porcine pancreatic polypeptide (PP) (47%). This result supports suggestions that the gene duplication events which led to PP, NPY and PYY formation took place after the time of divergence of fish and mammals.

Please choose payment method:






(PDF emailed within 0-6 h: $19.90)

Accession: 039520760

Download citation: RISBibTeXText

PMID: 3562898

DOI: 10.1016/0167-0115(86)90025-x


Related references

A second glucagon in the pancreatic islets of the daddy sculpin Cottus scorpius. General and Comparative Endocrinology 91(3): 281-286, 1993

Primary structure of three fragments of proglucagon from the pancreatic islets of the daddy sculpin (Cottus scorpius). European Journal of Biochemistry 1641: 117-122, 1987

Preliminary observations on the effect of bombesin on gastric muscle in the daddy sculpin Cottus scorpius. Regulatory Peptides 46: 382, 1982

The isolation, purification and amino-acid sequence of insulin from the teleost fish Cottus scorpius (daddy sculpin). European Journal of Biochemistry 158(1): 117-123, 1986

Islet amyloid polypeptide is expressed in the pancreatic islet parenchyma of the teleostean fish, Myoxocephalus (cottus) scorpius. Comparative Biochemistry and Physiology Part B Biochemistry and Molecular Biology 133B(1): 119-125, 2002

Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder. European Journal of Biochemistry 168(3): 647-652, 1987

Habitat separation of prickly sculpin, Cottus asper, and coastrange sculpin, Cottus aleuticus, in the mainstem Smith River, Northwestern California. Copeia 199(2): 371-375, 1999

Morphologically distinct populations of the shorthead sculpin cottus confusus and mottled sculpin cottus bairdi pisces cottidae near the western border of canada and the usa. Canadian Journal of Zoology 67(11): 2711-2720, 1989

Life history and status of the shorthead sculpin cottus confusus pisces cottidae in canada and the sympatric relationship to the slimy sculpin cottus cognatus. Canadian Journal of Zoology 62(2): 306-311, 1984

Morphologically distinct populations of the shorthead sculpin, Cottus confusus, and mottled sculpin, Cottus bairdi (Pisces, Cottidae), near the western border of Canada and the United States. Canadian Journal of Zoology 6711: 2711-2720, 1989

Ultrastructure of the pancreatic islet tissue of normal and alloxan-treated Cottus scorpius. Acta Endocrinologica 39: 32-46, 1962

On The Agranular Cells In The Pancreatic Islet Tissue Of The Marine Teleost Cottus Scorpius. Acta Pathologica et Microbiologica Scandinavica 60: 47-54, 1964

An intracorpusclar parasite in the blood of Cottus bubalis and Cottus scorpius. Journal of Pathology and Bacteriology Edinburgh, 18 224-227, 1913

Identification of the cells in the endocrine pancreatic tissue of the marine teleost Cottus scorpius by some silver impregnation procedures. Acta Morphologica Neerlando-Scandinavica 4: 145-152, 1961

Antifreeze proteins from the shorthorn sculpin, Myoxocephalus scorpius: isolation and characterization. Canadian Journal of Biochemistry 58(5): 377-383, 1980